PDB entry 1eg3

View 1eg3 on RCSB PDB site
Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Deposited on 2000-02-11, released 2000-08-23
The last revision prior to the SCOP 1.71 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eg3A (A:)
    gpasqhflstsvqgpweraispnkvpyyinhetqttcwdhpkmtelyqsladlnnvrfsa
    yrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrleqeh
    nnlvnvplcvdmclnwllnvydtgrtgrirvlsfktgiislckahledkyrylfkqvass
    tgfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqfannkpeieaalfldwm
    rlepqsmvwlpvlhrvaaaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg3A (A:)
    pasqhflstsvqgpweraispnkvpyyinhetqttcwdhpkmtelyqsladlnnvrfsay
    rtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrleqehn
    nlvnvplcvdmclnwllnvydtgrtgrirvlsfktgiislckahledkyrylfkqvasst
    gfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqfannkpeieaalfldwmr
    lepqsmvwlpvlhrvaaaet