PDB entry 1eg3

View 1eg3 on RCSB PDB site
Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Deposited on 2000-02-11, released 2000-08-23
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eg3A (A:)
    pasqhflstsvqgpweraispnkvpyyinhetqttcwdhpkmtelyqsladlnnvrfsay
    rtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrleqehn
    nlvnvplcvdmclnwllnvydtgrtgrirvlsfktgiislckahledkyrylfkqvasst
    gfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqfannkpeieaalfldwmr
    lepqsmvwlpvlhrvaaaet