PDB entry 1eg2

View 1eg2 on RCSB PDB site
Description: crystal structure of rhodobacter spheroides (n6 adenosine) methyltransferase (m.rsri)
Class: transferase
Keywords: Rossmann Fold, exocyclic amino DNA methyltransferase RsrI, DNA binding, DNA modification, DNA methylation, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2000-02-11, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase rsri
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eg2a_
  • Heterogens: MTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eg2A (A:)
    manrshhnaghramnalrksgqkhssesqlgsseigttrhvydvcdcldtlaklpddsvq
    liicdppynimladwddhmdyigwakrwlaeaervlsptgsiaifgglqyqgeagsgdli
    siishmrqnskmllanliiwnypngmsaqrffanrheeiawfaktkkyffdldavrepyd
    eetkaaymkdkrlnpesvekgrnptnvwrmsrlngnslervghptqkpaavierlvrals
    hpgstvldffagsgvtarvaiqegrnsictdaapvfkeyyqkqltflqddglidkarsye
    ivegaanfgaalqrgdvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg2A (A:)
    gttrhvydvcdcldtlaklpddsvqliicdppynimladwddhmdyigwakrwlaeaerv
    lsptgsiaifgglqyqgeagsgdlisiishmrqnskmllanliiwnypngmsaqrffanr
    heeiawfaktkkyffdldavrepydeetkaaymkdkrlnpesvekgrnptnvwrmsrlng
    nslervghptqkpaavierlvralshpgstvldffagsgvtarvaiqegrnsictdaapv
    fkeyyqkqltflrsyeivegaanfgaalqr