PDB entry 1eg1

View 1eg1 on RCSB PDB site
Description: endoglucanase I from trichoderma reesei
Class: cellulose degradation
Keywords: endoglucanase, mutation, cellulose degradation
Deposited on 1996-11-26, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.201
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase I
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eg1a_
  • Chain 'C':
    Compound: endoglucanase I
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eg1c_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eg1A (A:)
    eqpgtstpevhpklttykctksggcvaqdtsvvldwnyrwmhdanynsctvnggvnttlc
    pdeatcgkncfiegvdyaasgvttsgssltmnqympsssggyssvsprlylldsdgeyvm
    lklngqelsfdvdlsalpcgengslylsqmdengganqyntaganygsgycdaqcpvqtw
    rngtlntshqgfccnemdilegnsranaltphsctatacdsagcgfnpygsgyksyygpg
    dtvdtsktftiitqfntdngspsgnlvsitrkyqqngvdipsaqpggdtisscpsasayg
    glatmgkalssgmvlvfsiwndnsqymnwldsgnagpcsstegnpsnilannpnthvvfs
    nirwgdigstt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eg1C (C:)
    eqpgtstpevhpklttykctksggcvaqdtsvvldwnyrwmhdanynsctvnggvnttlc
    pdeatcgkncfiegvdyaasgvttsgssltmnqympsssggyssvsprlylldsdgeyvm
    lklngqelsfdvdlsalpcgengslylsqmdengganqyntaganygsgycdaqcpvqtw
    rngtlntshqgfccnemdilegnsranaltphsctatacdsagcgfnpygsgyksyygpg
    dtvdtsktftiitqfntdngspsgnlvsitrkyqqngvdipsaqpggdtisscpsasayg
    glatmgkalssgmvlvfsiwndnsqymnwldsgnagpcsstegnpsnilannpnthvvfs
    nirwgdigstt