PDB entry 1eg0

View 1eg0 on RCSB PDB site
Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome
Class: ribosome
Keywords: 70s ribosome, low resolution model
Deposited on 2000-02-11, released 2000-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: EM
Resolution: 11.5 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (s4 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81288 (0-158)
      • expression tag (0)
    Domains in SCOPe 2.06: d1eg0a1, d1eg0a2
  • Chain 'B':
    Compound: protein (s5 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0b_
  • Chain 'C':
    Compound: protein (s6 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0c_
  • Chain 'D':
    Compound: protein (s7 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0d_
  • Chain 'E':
    Compound: protein (s8 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PIR A53870 (Start-137)
    Domains in SCOPe 2.06: d1eg0e_
  • Chain 'F':
    Compound: protein (s15 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0f_
  • Chain 'G':
    Compound: protein (s17 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0g_
  • Chain 'H':
    Compound: protein (s20 ribosomal protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EG0 (0-99)
    Domains in SCOPe 2.06: d1eg0h_
  • Chain 'I':
    Compound: fragment of 16s rRNA helix 23
    Species: Escherichia coli [TaxId:562]
  • Chain 'J':
    Compound: protein (ribosomal protein l6)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0j_
  • Chain 'K':
    Compound: protein (ribosomal protein l11)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0k_
  • Chain 'L':
    Compound: fragment of 23s rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'M':
    Compound: helix 95 of 23s rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'N':
    Compound: protein (ribosomal protein l1)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eg0n_
  • Chain 'O':
    Compound: formyl-methionyl-tRNA
    Species: Escherichia coli [TaxId:562]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eg0A (A:)
    mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
    glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
    pdylsfdpekmegtytrlperselpaeinealivefysr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eg0B (B:)
    mrrinpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeai
    rkaiedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagi
    sdilsksigsntpinmvratfdglkqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0B (B:)
    inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
    iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
    lsksigsntpinmvratfdglkqlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eg0C (C:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eg0D (D:)
    marrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplk
    vfkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavri
    ahelmdaaegkggavkkkedvermae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0D (D:)
    lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
    rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
    ggavkkkedvermae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1eg0E (E:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0E (E:)
    tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
    lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
    earklgvggelicevw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1eg0F (F:)
    mpitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyralieklgirg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0F (F:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1eg0G (G:)
    sernqrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdiv
    kimetrplsatkrfrlveivekavragagagaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0G (G:)
    qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime
    trplsatkrfrlveivekavragagagaa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eg0H (H:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1eg0J (J:)
    msrvgkkpieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekh
    hralhgttrsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeeg
    leievpsqtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0J (J:)
    pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
    trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
    qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1eg0K (K:)
    makkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitv
    yedksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0K (K:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1eg0N (N:)
    mpkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg0N (N:)
    allekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvslphgl
    gkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklg
    rilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladn
    irafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

  • Chain 'O':
    No sequence available.