PDB entry 1efz

View 1efz on RCSB PDB site
Description: mutagenesis and crystallographic studies of zymomonas mobilis tRNA-guanine transglycosylase to elucidate the role of serine 103 for enzymatic activity
Class: transferase
Keywords: tRNA-modifying enzyme, transferase, glycosyltransferase
Deposited on 2000-02-11, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-guanine transglycosylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • engineered (102)
    Domains in SCOPe 2.07: d1efza_
  • Heterogens: ZN, PRF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efzA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdaggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efzA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdaggyqvmslssltkqseegvtfkshldg
    srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
    eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
    lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
    lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
    sqfaqdfraryf