PDB entry 1efy

View 1efy on RCSB PDB site
Description: crystal structure of the catalytic fragment of poly (ADP-ribose) polymerase complexed with a benzimidazole inhibitor
Class: transferase
Keywords: benzimidazole, inhibitor, catalytic fragment, polymerase, transferase
Deposited on 2000-02-10, released 2001-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poly (ADP-ribose) polymerase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efya1, d1efya2
  • Heterogens: BZC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efyA (A:)
    ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
    dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
    nedgdkdpidinyeklrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrier
    egesqrykpfkqlhnrqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqadpiglillgevalgnmyelknashitklpkgkhsvkglgktapdptat
    ttldgvevplgngistgindtcllyneyivydvaqvnlkyllklkfnykt