PDB entry 1efv

View 1efv on RCSB PDB site
Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution
Deposited on 1996-10-16, released 1997-12-03
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efvA (A:)
    qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
    qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
    spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
    ldqkltksdrpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpn
    dmqvgqtgkivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadl
    fkvvpemteilk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efvB (B:)
    lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
    vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
    kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta
    dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
    dlvaklkeigri