PDB entry 1efv

View 1efv on RCSB PDB site
Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution
Class: electron transport
Keywords: electron transport, flavoprotein, glutaric acidemia type II
Deposited on 1996-10-16, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: electron transfer flavoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efva1, d1efva2
  • Chain 'B':
    Compound: electron transfer flavoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efvb_
  • Heterogens: FAD, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efvA (A:)
    mqstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlv
    aqhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiai
    kspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveise
    wldqkltksdrpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvp
    ndmqvgqtgkivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivad
    lfkvvpemteilkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efvA (A:)
    qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
    qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
    spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
    ldqkltksdrpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpn
    dmqvgqtgkivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadl
    fkvvpemteilk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efvB (B:)
    maelrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvke
    viavscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlv
    llgkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpav
    vtadlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkve
    ttedlvaklkeigri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efvB (B:)
    lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
    vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
    kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta
    dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
    dlvaklkeigri