PDB entry 1efq

View 1efq on RCSB PDB site
Description: Q38D mutant of LEN
Class: immune system
Keywords: Human Kappa-4 Immunoglobulin Light Chain, Mutant, Monomer, Uranyl ion in crystal contact, Aspartic Acid in beta-sheet, Protein Stability
Deposited on 2000-02-09, released 2001-02-09
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.23
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kappa-4 immunoglobulin (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625 (0-End)
      • engineered (43)
    Domains in SCOP 1.75: d1efqa_
  • Heterogens: IUM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1efqA (A:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqdkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

    Sequence, based on observed residues (ATOM records): (download) 
    >1efqA (A:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqdkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik