PDB entry 1efq
View 1efq on RCSB PDB site
Description: Q38D mutant of LEN
Class: immune system
Keywords: Human Kappa-4 Immunoglobulin Light Chain, Mutant, Monomer, Uranyl ion in crystal contact, Aspartic Acid in beta-sheet, Protein Stability, IMMUNE SYSTEM
Deposited on
2000-02-09, released
2001-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.23
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: kappa-4 immunoglobulin (light chain)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1efqa_ - Heterogens: IUM, ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1efqA (A:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqdkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr
Sequence, based on observed residues (ATOM records): (download)
>1efqA (A:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqdkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik