PDB entry 1efp

View 1efp on RCSB PDB site
Description: electron transfer flavoprotein (etf) from paracoccus denitrificans
Deposited on 1998-12-18, released 1999-08-09
The last revision prior to the SCOP 1.67 freeze date was dated 1999-08-09, with a file datestamp of 1999-08-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efpA (A:)
    avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
    dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
    tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
    vaesdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqv
    gqtgkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvv
    peltgkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efpB (B:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgklkeagvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efpB (B:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efpC (C:)
    avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
    dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
    tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
    vaesdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqv
    gqtgkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvv
    peltgkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1efpD (D:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgklkeagvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efpD (D:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgkl