PDB entry 1efp

View 1efp on RCSB PDB site
Description: electron transfer flavoprotein (etf) from paracoccus denitrificans
Class: electron transport
Keywords: electron transport, flavoprotein, glutaric acidemia type II
Deposited on 1998-12-18, released 1999-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (electron transfer flavoprotein)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efpa1, d1efpa2
  • Chain 'B':
    Compound: protein (electron transfer flavoprotein)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efpb_
  • Chain 'C':
    Compound: protein (electron transfer flavoprotein)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efpc1, d1efpc2
  • Chain 'D':
    Compound: protein (electron transfer flavoprotein)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efpd_
  • Heterogens: FAD, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efpA (A:)
    avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
    dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
    tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
    vaesdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqv
    gqtgkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvv
    peltgkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efpB (B:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgklkeagvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efpB (B:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efpC (C:)
    avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
    dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
    tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
    vaesdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqv
    gqtgkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvv
    peltgkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1efpD (D:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgklkeagvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efpD (D:)
    mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
    vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
    kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
    dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
    elvgkl