PDB entry 1efn

View 1efn on RCSB PDB site
Description: hiv-1 nef protein in complex with r96i mutant fyn sh3 domain
Class: complex (sh3 domain/viral enhancer)
Keywords: complex (sh3 domain/viral enhancer), proto-oncogene, transferase, tyrosine-protein kinase, phosphorylation, aids, myristylation, GTP-binding, ATP-binding, sh3 domain, sh2 domain, ppii helix, pxxp motif
Deposited on 1996-06-29, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fyn tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIV-1 NEF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06241 (1-End)
      • engineered (11)
    Domains in SCOPe 2.07: d1efna_
  • Chain 'B':
    Compound: hiv-1 nef protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 NEF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03406
      • engineered (17)
    Domains in SCOPe 2.07: d1efnb_
  • Chain 'C':
    Compound: fyn tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIV-1 NEF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06241 (1-End)
      • engineered (11)
    Domains in SCOPe 2.07: d1efnc_
  • Chain 'D':
    Compound: hiv-1 nef protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 NEF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03406
      • engineered (17)
    Domains in SCOPe 2.07: d1efnd_
  • Heterogens: PBM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efnA (A:)
    alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efnA (A:)
    alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efnB (B:)
    acawleaqeeeevgfpvrpqvplrpmtykaavdlshflkekggleglihsqrrqdildlw
    iyhtqgyfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgm
    ddperevlewrfdsrlafhhvarelhpeyfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efnB (B:)
    rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
    pgvrypltfgwcyklvpvrevlewrfdsrlafhhvarelhpeyf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1efnC (C:)
    alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efnC (C:)
    alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1efnD (D:)
    acawleaqeeeevgfpvrpqvplrpmtykaavdlshflkekggleglihsqrrqdildlw
    iyhtqgyfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgm
    ddperevlewrfdsrlafhhvarelhpeyfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efnD (D:)
    rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
    pgvrypltfgwcyklvpvrevlewrfdsrlafhhvarelhpeyf