PDB entry 1efk

View 1efk on RCSB PDB site
Description: structure of human malic enzyme in complex with ketomalonate
Class: oxidoreductase
Keywords: malic enzyme, closed form, quaternary complex, OXIDOREDUCTASE
Deposited on 2000-02-09, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368
      • modified residue (28)
      • modified residue (37)
      • modified residue (46)
      • modified residue (74)
      • modified residue (85)
      • modified residue (107)
      • modified residue (176)
      • modified residue (218)
      • modified residue (238)
      • modified residue (324)
      • modified residue (326)
      • modified residue (342)
      • modified residue (406)
      • modified residue (538)
    Domains in SCOPe 2.07: d1efka1, d1efka2
  • Chain 'B':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368
      • modified residue (28)
      • modified residue (37)
      • modified residue (46)
      • modified residue (74)
      • modified residue (85)
      • modified residue (107)
      • modified residue (176)
      • modified residue (218)
      • modified residue (238)
      • modified residue (324)
      • modified residue (326)
      • modified residue (342)
      • modified residue (406)
      • modified residue (538)
    Domains in SCOPe 2.07: d1efkb1, d1efkb2
  • Chain 'C':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368
      • modified residue (28)
      • modified residue (37)
      • modified residue (46)
      • modified residue (74)
      • modified residue (85)
      • modified residue (107)
      • modified residue (176)
      • modified residue (218)
      • modified residue (238)
      • modified residue (324)
      • modified residue (326)
      • modified residue (342)
      • modified residue (406)
      • modified residue (538)
    Domains in SCOPe 2.07: d1efkc1, d1efkc2
  • Chain 'D':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368
      • modified residue (28)
      • modified residue (37)
      • modified residue (46)
      • modified residue (74)
      • modified residue (85)
      • modified residue (107)
      • modified residue (176)
      • modified residue (218)
      • modified residue (238)
      • modified residue (324)
      • modified residue (326)
      • modified residue (342)
      • modified residue (406)
      • modified residue (538)
    Domains in SCOPe 2.07: d1efkd1, d1efkd2
  • Heterogens: MG, NAD, MAK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efkA (A:)
    mlsrlrvvsttctlacrhlhikekgkplmlnprtnkgmaftlqerqmlglqgllppkiet
    qdiqalrfhrnlkkmtsplekyiyimgiqerneklfyrilqddieslmpivytptvglac
    sqyghifrrpkglfisisdrghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgip
    vgklclytacagirpdrclpvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmk
    aitdrygrntliqfedfgnhnafrflrkyrekyctfnddiqgtaavalagllaaqkvisk
    pisehkilflgageaalgianlivmsmvenglseqeaqkkiwmfdkygllvkgrkakids
    yqepfthsapesipdtfedavnilkpstiigvagagrlftpdviramasinerpvifals
    nptaqaectaeeaytltegrclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavil
    cntrhisdsvfleaakaltsqltdeelaqgrlypplaniqevsiniaikvteylyankma
    frypepedkakyvkertwrseydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efkA (A:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efkB (B:)
    mlsrlrvvsttctlacrhlhikekgkplmlnprtnkgmaftlqerqmlglqgllppkiet
    qdiqalrfhrnlkkmtsplekyiyimgiqerneklfyrilqddieslmpivytptvglac
    sqyghifrrpkglfisisdrghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgip
    vgklclytacagirpdrclpvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmk
    aitdrygrntliqfedfgnhnafrflrkyrekyctfnddiqgtaavalagllaaqkvisk
    pisehkilflgageaalgianlivmsmvenglseqeaqkkiwmfdkygllvkgrkakids
    yqepfthsapesipdtfedavnilkpstiigvagagrlftpdviramasinerpvifals
    nptaqaectaeeaytltegrclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavil
    cntrhisdsvfleaakaltsqltdeelaqgrlypplaniqevsiniaikvteylyankma
    frypepedkakyvkertwrseydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efkB (B:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1efkC (C:)
    mlsrlrvvsttctlacrhlhikekgkplmlnprtnkgmaftlqerqmlglqgllppkiet
    qdiqalrfhrnlkkmtsplekyiyimgiqerneklfyrilqddieslmpivytptvglac
    sqyghifrrpkglfisisdrghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgip
    vgklclytacagirpdrclpvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmk
    aitdrygrntliqfedfgnhnafrflrkyrekyctfnddiqgtaavalagllaaqkvisk
    pisehkilflgageaalgianlivmsmvenglseqeaqkkiwmfdkygllvkgrkakids
    yqepfthsapesipdtfedavnilkpstiigvagagrlftpdviramasinerpvifals
    nptaqaectaeeaytltegrclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavil
    cntrhisdsvfleaakaltsqltdeelaqgrlypplaniqevsiniaikvteylyankma
    frypepedkakyvkertwrseydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efkC (C:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1efkD (D:)
    mlsrlrvvsttctlacrhlhikekgkplmlnprtnkgmaftlqerqmlglqgllppkiet
    qdiqalrfhrnlkkmtsplekyiyimgiqerneklfyrilqddieslmpivytptvglac
    sqyghifrrpkglfisisdrghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgip
    vgklclytacagirpdrclpvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmk
    aitdrygrntliqfedfgnhnafrflrkyrekyctfnddiqgtaavalagllaaqkvisk
    pisehkilflgageaalgianlivmsmvenglseqeaqkkiwmfdkygllvkgrkakids
    yqepfthsapesipdtfedavnilkpstiigvagagrlftpdviramasinerpvifals
    nptaqaectaeeaytltegrclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavil
    cntrhisdsvfleaakaltsqltdeelaqgrlypplaniqevsiniaikvteylyankma
    frypepedkakyvkertwrseydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efkD (D:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp