PDB entry 1efi

View 1efi on RCSB PDB site
Description: heat-labile enterotoxin b-pentamer complexed with para-aminophenyl-alpha-d-galactopyranoside
Class: toxin
Keywords: enterotoxin
Deposited on 2000-02-08, released 2000-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: protein (heat-labile enterotoxin b chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efid_
  • Chain 'E':
    Compound: protein (heat-labile enterotoxin b chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efie_
  • Chain 'F':
    Compound: protein (heat-labile enterotoxin b chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efif_
  • Chain 'G':
    Compound: protein (heat-labile enterotoxin b chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efig_
  • Chain 'H':
    Compound: protein (heat-labile enterotoxin b chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efih_
  • Heterogens: GAT, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efiD (D:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efiE (E:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efiF (F:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efiG (G:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efiH (H:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn