PDB entry 1efe

View 1efe on RCSB PDB site
Description: an active mini-proinsulin, m2pi
Class: hormone/growth factor
Keywords: nmr, linker, insulin, proinsulin, hormone/growth factor complex
Deposited on 2000-02-08, released 2000-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mini-proinsulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (39-59)
    • see remark 999 (30-38)
  Domains in SCOPe 2.08: d1efea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1efeA (A:)
  fvnqhlcgshlvealylvcgergffytpktrrypgdvkrgiveqcctsicslyqlenycn