PDB entry 1efd

View 1efd on RCSB PDB site
Description: periplasmic ferric siderophore binding protein fhud complexed with gallichrome
Class: metal transport
Keywords: periplasmic binding protein-siderophore complex, FhuD complex with gallichrome, Escherichia coli, ferric siderophore binding protein, METAL TRANSPORT
Deposited on 2000-02-07, released 2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: ferrichrome-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1efdn_
  • Heterogens: GCR, HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1efdN (N:)
    agidpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnle
    lltemkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsa
    aethlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnaw
    qgetnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvp
    avwfygatlsamhfvrvldnaiggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efdN (N:)
    gidpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnlel
    ltemkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsaa
    ethlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnawq
    getnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvpa
    vwfygatlsamhfvrvldnaig