PDB entry 1efa

View 1efa on RCSB PDB site
Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
Class: transcription/DNA
Keywords: protein-dna complex, helix-turn-helix, gene regulation, molecular switch, TRANSCRIPTION-DNA COMPLEX
Deposited on 2000-02-07, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.247
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • engineered (108)
    Domains in SCOPe 2.07: d1efaa1, d1efaa2
  • Chain 'B':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • engineered (108)
    Domains in SCOPe 2.07: d1efab1, d1efab2
  • Chain 'C':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • engineered (108)
    Domains in SCOPe 2.07: d1efac1, d1efac2
  • Chain 'D':
    Compound: DNA (5'-d(*gp*ap*ap*t*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*ap*ap*t*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3')
  • Heterogens: NPF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efaA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efaA (A:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkqs
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrktt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efaB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efaB (B:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkqs
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1efaC (C:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efaC (C:)
    nyipnrvaqqlagkqslligvatsslalhapsqivaaiksradqlgasvvvsmversgve
    acktavhnllaqrvsgliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshed
    gtrlgvehlvalghqqiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsg
    fqqtmqmlnegivptamlvandqmalgamraitesglrvgadisvvgyddtedsscyipp
    lttikqdfrllgqtsvdrllqlsqgqavkgnqllpvslvkrkttla
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.