PDB entry 1ef9

View 1ef9 on RCSB PDB site
Description: the crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa
Deposited on 2000-02-07, released 2000-05-24
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-24, with a file datestamp of 2000-05-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ef9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef9A (A:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
    iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
    vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
    edyqegmnaflekrkpnfvgh