PDB entry 1ef9

View 1ef9 on RCSB PDB site
Description: the crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa
Class: lyase
Keywords: methylmalonyl coa decarboxylase, 2S-carboxypropyl, LYASE
Deposited on 2000-02-07, released 2000-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylmalonyl coa decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ef9a_
  • Heterogens: 2CP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef9A (A:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
    iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
    vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
    edyqegmnaflekrkpnfvgh