PDB entry 1ef8

View 1ef8 on RCSB PDB site
Description: crystal structure of methylmalonyl coa decarboxylase
Class: lyase
Keywords: methylmalonyl coa, decarboxylase, LYASE
Deposited on 2000-02-07, released 2000-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylmalonyl coa decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ef8a_
  • Chain 'B':
    Compound: methylmalonyl coa decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ef8b_
  • Chain 'C':
    Compound: methylmalonyl coa decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ef8c_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ef8A (A:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
    iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
    vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
    edyqegmnaflekrkpnfvgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef8A (A:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdiheldplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdliiaas
    tstfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhvveve
    eledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydsedyqe
    gmnaflekrkpnfvgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ef8B (B:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
    iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
    vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
    edyqegmnaflekrkpnfvgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef8B (B:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdidplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdliiaastst
    fsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhvveveele
    dftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydsedyqegmn
    aflekrkpnfvgh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ef8C (C:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
    iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
    vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
    edyqegmnaflekrkpnfvgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef8C (C:)
    msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
    vfsaghdlsyddplrqitrmiqkfpkpiismvegsvwggafemimssdliiaaststfsm
    tpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhvveveeledft
    lqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydsedyqegmnafl
    ekrkpnfvgh