PDB entry 1ef7

View 1ef7 on RCSB PDB site
Description: crystal structure of human cathepsin x
Class: hydrolase
Keywords: papain-like, cysteine protease, carboxypeptidase, cathepsin, HYDROLASE
Deposited on 2000-02-07, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.183
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin x
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ef7a_
  • Chain 'B':
    Compound: cathepsin x
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ef7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef7A (A:)
    lpkswdwrnvdgvnyasitrnqhipqycgscwahastsamadrinikrkgawpstllsvq
    nvidcgnagsceggndlsvwdyahqhgipdetcnnyqakdqecdkfnqcgtcnefkecha
    irnytlwrvgdygslsgrekmmaeiyangpiscgimaterlanytggiyaeyqdttyinh
    vvsvagwgisdgteywivrnswgepwgergwlrivtstykdgkgarynlaieehctfgdp
    iv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef7B (B:)
    lpkswdwrnvdgvnyasitrnqhipqycgscwahastsamadrinikrkgawpstllsvq
    nvidcgnagsceggndlsvwdyahqhgipdetcnnyqakdqecdkfnqcgtcnefkecha
    irnytlwrvgdygslsgrekmmaeiyangpiscgimaterlanytggiyaeyqdttyinh
    vvsvagwgisdgteywivrnswgepwgergwlrivtstykdgkgarynlaieehctfgdp
    iv