PDB entry 1ef5

View 1ef5 on RCSB PDB site
Description: solution structure of the ras-binding domain of rgl
Class: signaling protein
Keywords: RAS-BINDING DOMAIN, RGL, RAS, RBD, RA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, SIGNALING PROTEIN
Deposited on 2000-02-07, released 2000-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rgl
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60695 (Start-102)
      • see remark 999 (30)
    Domains in SCOPe 2.06: d1ef5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ef5A (A:)
    sitstvlppvynqqnedtciirisvednngnmyksimltsqdktpaviqramskhnlesd
    paeeyelvqvisedkelvipdsanvfyamnsqvnfdfilrkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef5A (A:)
    edtciirisvednngnmyksimltsqdktpaviqramskhnlesdpaeeyelvqvisedk
    elvipdsanvfyamnsqvnfdfilrkkn