PDB entry 1ef5

View 1ef5 on RCSB PDB site
Description: solution structure of the ras-binding domain of rgl
Deposited on 2000-02-07, released 2000-02-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-23, with a file datestamp of 2000-02-23.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1ef5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ef5A (A:)
  edtciirisvednngnmyksimltsqdktpaviqramskhnlesdpaeeyelvqvisedk
  elvipdsanvfyamnsqvnfdfilrkkn