PDB entry 1ef5

View 1ef5 on RCSB PDB site
Description: solution structure of the ras-binding domain of rgl
Class: signaling protein
Keywords: RAS-BINDING DOMAIN, RGL, RAS, RBD, RA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, SIGNALING PROTEIN
Deposited on 2000-02-07, released 2000-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rgl
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60695 (Start-102)
    • see remark 999 (30)
  Domains in SCOPe 2.08: d1ef5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ef5A (A:)
  sitstvlppvynqqnedtciirisvednngnmyksimltsqdktpaviqramskhnlesd
  paeeyelvqvisedkelvipdsanvfyamnsqvnfdfilrkkn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ef5A (A:)
  edtciirisvednngnmyksimltsqdktpaviqramskhnlesdpaeeyelvqvisedk
  elvipdsanvfyamnsqvnfdfilrkkn