PDB entry 1ef4

View 1ef4 on RCSB PDB site
Description: solution structure of the essential RNA polymerase subunit rpb10 from methanobacterium thermoautotrophicum
Class: transferase
Keywords: THREE HELIX BUNDLE, ZINC BINDING, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2000-02-07, released 2000-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase
    Species: Methanobacterium thermoformicicum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ef4a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef4A (A:)
    mipvrclscgkpvsayfneyqrrvadgedpkdvlddlglkryccrrmlishvetw