PDB entry 1ef4

View 1ef4 on RCSB PDB site
Description: solution structure of the essential rna polymerase subunit rpb10 from methanobacterium thermoautotrophicum
Deposited on 2000-02-07, released 2000-06-14
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-02, with a file datestamp of 2000-08-02.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ef4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef4A (A:)
    mipvrclscgkpvsayfneyqrrvadgedpkdvlddlglkryccrrmlishvetw