PDB entry 1ef2

View 1ef2 on RCSB PDB site
Description: crystal structure of manganese-substituted klebsiella aerogenes urease
Class: hydrolase
Keywords: alpha-beta barrel, metalloenzyme, HYDROLASE
Deposited on 2000-02-05, released 2000-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease alpha subunit
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ef2a1, d1ef2a2
  • Chain 'B':
    Compound: urease beta subunit
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ef2b_
  • Chain 'C':
    Compound: urease gamma subunit
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ef2c_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef2A (A:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef2B (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef2C (C:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii