PDB entry 1ef2

View 1ef2 on RCSB PDB site
Description:
Deposited on 2000-02-05, released 2000-03-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-09, with a file datestamp of 2000-03-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1ef2a1, d1ef2a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1ef2b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1ef2c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef2A (A:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef2B (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef2C (C:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii