PDB entry 1ef1

View 1ef1 on RCSB PDB site
Description: crystal structure of the moesin ferm domain/tail domain complex
Deposited on 2000-02-04, released 2000-05-10
The last revision prior to the SCOP 1.69 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1A (A:)
    tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
    kvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppetav
    llasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehrgml
    redavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpws
    eirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1B (B:)
    tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
    kvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppetav
    llasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehrgml
    redavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpws
    eirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1C (C:)
    aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
    nmrlgrdkyktlrqirqgntkqridefesm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1D (D:)
    aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
    nmrlgrdkyktlrqirqgntkqridefesm