PDB entry 1ef1

View 1ef1 on RCSB PDB site
Description: crystal structure of the moesin ferm domain/tail domain complex
Class: membrane protein
Keywords: membrane, FERM domain, Tail domain, MEMBRANE PROTEIN
Deposited on 2000-02-04, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: moesin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26038 (0-293)
      • modified residue (8)
      • modified residue (178)
      • modified residue (196)
      • modified residue (281)
      • modified residue (288)
    Domains in SCOPe 2.07: d1ef1a1, d1ef1a2, d1ef1a3
  • Chain 'B':
    Compound: moesin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26038 (0-293)
      • modified residue (8)
      • modified residue (178)
      • modified residue (196)
      • modified residue (281)
      • modified residue (288)
    Domains in SCOPe 2.07: d1ef1b1, d1ef1b2, d1ef1b3
  • Chain 'C':
    Compound: moesin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26038 (0-89)
      • modified residue (55)
      • modified residue (61)
      • modified residue (89)
    Domains in SCOPe 2.07: d1ef1c_
  • Chain 'D':
    Compound: moesin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26038 (0-89)
      • modified residue (55)
      • modified residue (61)
      • modified residue (89)
    Domains in SCOPe 2.07: d1ef1d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1A (A:)
    tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
    kvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppetav
    llasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehrgml
    redavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpws
    eirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1B (B:)
    tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
    kvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppetav
    llasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehrgml
    redavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpws
    eirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1C (C:)
    aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
    nmrlgrdkyktlrqirqgntkqridefesm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef1D (D:)
    aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
    nmrlgrdkyktlrqirqgntkqridefesm