PDB entry 1ef0

View 1ef0 on RCSB PDB site
Description: crystal structure of pi-scei miniprecursor
Deposited on 2000-02-04, released 2000-06-07
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.231
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ef0A (A:)
    klegafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqh
    rahksdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapd
    grivelvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkaty
    qtyapilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslm
    ervteyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgfl
    kdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslars
    lglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarec
    rgfyfelqelkeddyygitlsddsdhqfllanqvvvhacger
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef0A (A:)
    egafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhra
    hksdssrevpellkftcnathelvvrtprsvrvitfemgqkkapdgrivelvkevsksyp
    isegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhffd
    ymqksktiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykd
    rkepqvaktvnlysenplwdaivglgflkdgvknipsflstdnigtretflaglidsdgy
    vtdehgikatiktihtsvrdglvslarslglvvsvnaepakvdgtkhkisyaiymsggdv
    llnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfllanqv
    vvhac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ef0B (B:)
    klegafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqh
    rahksdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapd
    grivelvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkaty
    qtyapilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslm
    ervteyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgfl
    kdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslars
    lglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarec
    rgfyfelqelkeddyygitlsddsdhqfllanqvvvhacger
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef0B (B:)
    klegafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqkslk
    ftcnathelvvrtprsvrrlsrveyfevitfemgqkkapdgrivelvkevsksypisegp
    eranelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhffdymqkv
    layllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykdrkepqvaktvnly
    sglgflkdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdgl
    vslarslglvvsvnisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfyfelq
    elkeddyygitlsddsdhqfllanqvvvhacger