PDB entry 1ef0

View 1ef0 on RCSB PDB site
Description: crystal structure of pi-scei miniprecursor
Class: hydrolase
Keywords: endonuclease, protein splicing, mini-precursor, HYDROLASE
Deposited on 2000-02-04, released 2000-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pi-scei endonuclease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB AAB63978 (4-458)
      • see remark 999 (2-3)
      • engineered (4)
      • engineered (457)
    Domains in SCOPe 2.08: d1ef0a1, d1ef0a2, d1ef0a3
  • Chain 'B':
    Compound: pi-scei endonuclease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB AAB63978 (4-458)
      • see remark 999 (0-3)
      • engineered (4)
      • engineered (457)
      • see remark 999 (459-461)
    Domains in SCOPe 2.08: d1ef0b1, d1ef0b2, d1ef0b3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ef0A (A:)
    klegafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqh
    rahksdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapd
    grivelvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkaty
    qtyapilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslm
    ervteyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgfl
    kdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslars
    lglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarec
    rgfyfelqelkeddyygitlsddsdhqfllanqvvvhacger
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef0A (A:)
    egafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhra
    hksdssrevpellkftcnathelvvrtprsvrvitfemgqkkapdgrivelvkevsksyp
    isegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhffd
    ymqksktiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykd
    rkepqvaktvnlysenplwdaivglgflkdgvknipsflstdnigtretflaglidsdgy
    vtdehgikatiktihtsvrdglvslarslglvvsvnaepakvdgtkhkisyaiymsggdv
    llnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfllanqv
    vvhac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ef0B (B:)
    klegafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqh
    rahksdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapd
    grivelvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkaty
    qtyapilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslm
    ervteyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgfl
    kdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslars
    lglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarec
    rgfyfelqelkeddyygitlsddsdhqfllanqvvvhacger
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ef0B (B:)
    klegafakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqkslk
    ftcnathelvvrtprsvrrlsrveyfevitfemgqkkapdgrivelvkevsksypisegp
    eranelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhffdymqkv
    layllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykdrkepqvaktvnly
    sglgflkdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdgl
    vslarslglvvsvnisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfyfelq
    elkeddyygitlsddsdhqfllanqvvvhacger