PDB entry 1eeu

View 1eeu on RCSB PDB site
Description: M4L/Y(27D)D/Q89D/T94H mutant of LEN
Class: immune system
Keywords: Human Kappa-4 Immunoglobulin Light Chain, Mutant, Aspartic Acid in beta-sheet, Protein Stability, IMMUNE SYSTEM
Deposited on 2000-02-03, released 2001-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kappa-4 immunoglobulin (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625
      • engineered (3)
      • engineered (26)
      • engineered (94)
      • engineered (99)
    Domains in SCOPe 2.08: d1eeua_
  • Chain 'B':
    Compound: kappa-4 immunoglobulin (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625 (0-End)
      • engineered (3)
      • engineered (26)
      • engineered (94)
      • engineered (99)
    Domains in SCOPe 2.08: d1eeub_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eeuA (A:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eeuA (A:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtklei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eeuB (B:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eeuB (B:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtkleik