PDB entry 1eet

View 1eet on RCSB PDB site
Description:
Deposited on 2000-02-03, released 2001-02-07
The last revision prior to the SCOP 1.71 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1eeta1, d1eeta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1eetb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eetA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eetA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpyntpvfai
    kwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkyta
    ftipsgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddlyvgsdlei
    gqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpekdswtvn
    diqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvh
    gvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqki
    ttesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlekepiv
    gaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlqaiylalqdsglevni
    vtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdklvsag
    ir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eetB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eetB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrwglmgyelhpdkwtvqpivlpekdswtvndiqk
    lvgklnwasqiypgikvrqlckltkalteviplteeaelelaenreilkepvhgvyydps
    kdliaeiqkqgqgqwtyqiyqepfknlktgkyatndvkqlteavqkittesiviwgktpk
    fklpiqketwetwwteywqatwipewefvntpplvklwy