PDB entry 1eeq

View 1eeq on RCSB PDB site
Description: M4L/Y(27D)D/T94H Mutant of LEN
Class: immune system
Keywords: Human Kappa-4 Immunoglobulin Light chain, Protein Stability, Hydrogen Bonds
Deposited on 2000-02-01, released 2001-02-01
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.211
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kappa-4 immunoglobulin (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625
      • engineered (3)
      • engineered (26)
      • engineered (99)
    Domains in SCOP 1.75: d1eeqa_
  • Chain 'B':
    Compound: kappa-4 immunoglobulin (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625 (0-End)
      • engineered (3)
      • engineered (26)
      • engineered (99)
    Domains in SCOP 1.75: d1eeqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eeqA (A:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eeqA (A:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eeqB (B:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eeqB (B:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleik