PDB entry 1eep

View 1eep on RCSB PDB site
Description: 2.4 a resolution crystal structure of borrelia burgdorferi inosine 5'-monphosphate dehydrogenase in complex with a sulfate ion
Class: oxidoreductase
Keywords: alpha-beta barrel, tim barrel, impdh, imp dehydrogenase, loop-6, purine biosynthesis, oxidoreductase
Deposited on 2000-02-01, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine 5'-monophosphate dehydrogenase
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eepa_
  • Chain 'B':
    Compound: inosine 5'-monophosphate dehydrogenase
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eepb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eepA (A:)
    mpnkitkealtfddvsliprkssvlpsevslktqltknislnipflssamdtvtesqmai
    aiakeggigiihknmsieaqrkeiekvktykfqktintngdtneqkpeiftakqhleksd
    ayknaehkedfpnackdlnnklrvgaavsididtierveelvkahvdilvidsahghstr
    iielikkiktkypnldliagnivtkeaaldlisvgadclkvgigpgsicttrivagvgvp
    qitaicdvyeacnntniciiadggirfsgdvvkaiaagadsvmignlfagtkespseeii
    yngkkfksyvgmgsisamkrgsksryfqlennepkklvpegiegmvpysgklkdiltqlk
    gglmsgmgylgaatisdlkinskfvkishsslkeshphdvfsit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eepA (A:)
    nkitkealtfddvsliprkssvlpsevslktqltknislnipflssamdtvtesqmaiai
    akeggigiihknmsieaqrkeiekvktykdfpnackdlnnklrvgaavsididtiervee
    lvkahvdilvidsahghstriielikkiktkypnldliagnivtkeaaldlisvgadclk
    vgigpgsicttrivagvgvpqitaicdvyeacnntniciiadggirfsgdvvkaiaagad
    svmignlfagtkespseeiiyngkkfksmvpysgklkdiltqlkgglmsgmgylgaatis
    dlkinskfvkishs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eepB (B:)
    mpnkitkealtfddvsliprkssvlpsevslktqltknislnipflssamdtvtesqmai
    aiakeggigiihknmsieaqrkeiekvktykfqktintngdtneqkpeiftakqhleksd
    ayknaehkedfpnackdlnnklrvgaavsididtierveelvkahvdilvidsahghstr
    iielikkiktkypnldliagnivtkeaaldlisvgadclkvgigpgsicttrivagvgvp
    qitaicdvyeacnntniciiadggirfsgdvvkaiaagadsvmignlfagtkespseeii
    yngkkfksyvgmgsisamkrgsksryfqlennepkklvpegiegmvpysgklkdiltqlk
    gglmsgmgylgaatisdlkinskfvkishsslkeshphdvfsit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eepB (B:)
    nkitkealtfddvsliprkssvlpsevslktqltknislnipflssamdtvtesqmaiai
    akeggigiihknmsieaqrkeiekvktydfpnackdlnnklrvgaavsididtierveel
    vkahvdilvidsahghstriielikkiktkypnldliagnivtkeaaldlisvgadclkv
    gigpgsicttrivagvgvpqitaicdvyeacnntniciiadggirfsgdvvkaiaagads
    vmignlfagtkespseeiiyngkkfksygmvpysgklkdiltqlkgglmsgmgylgaati
    sdlkinskfvkish