PDB entry 1eei

View 1eei on RCSB PDB site
Description: cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d-galactose
Class: toxin
Keywords: toxin,enterotoxin
Deposited on 2000-01-31, released 2000-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: protein (cholera toxin b)
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eeid_
  • Chain 'E':
    Compound: protein (cholera toxin b)
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eeie_
  • Chain 'F':
    Compound: protein (cholera toxin b)
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eeif_
  • Chain 'G':
    Compound: protein (cholera toxin b)
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eeig_
  • Chain 'H':
    Compound: protein (cholera toxin b)
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eeih_
  • Heterogens: GAA, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eeiD (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eeiE (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eeiF (F:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eeiG (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eeiH (H:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman