PDB entry 1eeh

View 1eeh on RCSB PDB site
Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
Class: ligase
Keywords: ligase, peptidoglycan synthesis, murd, ADP-forming enzyme
Deposited on 2000-01-31, released 2001-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eeha1, d1eeha2, d1eeha3
  • Heterogens: UMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eehA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eehA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhlt
    wlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfevv
    lehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnvrl
    ycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeqrg
    nefarlakelg