PDB entry 1eee

View 1eee on RCSB PDB site
Description: crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa
Class: oxidoreductase
Keywords: quinoprotein, superbarrel, dehydrogenase
Deposited on 2000-01-31, released 2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-08-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.142
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinoprotein ethanol dehydrogenase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • GB CAA08896 (0-581)
    Domains in SCOPe 2.07: d1eeea_
  • Chain 'B':
    Compound: quinoprotein ethanol dehydrogenase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • GB CAA08896 (0-581)
    Domains in SCOPe 2.07: d1eeeb_
  • Heterogens: CA, NA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eeeA (A:)
    kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
    esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
    ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
    gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
    shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
    gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
    afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
    qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
    ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
    eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eeeB (B:)
    kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
    esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
    ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
    gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
    shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
    gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
    afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
    qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
    ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
    eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw