PDB entry 1eed

View 1eed on RCSB PDB site
Description: X-ray crystallographic analysis of inhibition of endothiapepsin by cyclohexyl renin inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1992-06-15, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eedp_
  • Heterogens: 0EO, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eedP (P:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask