PDB entry 1ee9

View 1ee9 on RCSB PDB site
Description: crystal structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae complexed with nad
Deposited on 2000-01-31, released 2000-12-06
The last revision prior to the SCOP 1.57 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee9A (A:)
    kpgrtilaskvaetfnteiinnveeykkthngqgpllvgflanndpaakmyatwtqktse
    smgfrydlrviedkdfleeaiiqangddsvngimvyfpvfgnaqdqylqqvvckekdveg
    lnhvyyqnlyhnvryldkenrlksilpctplaivkileflkiynnllpegnrlygkkciv
    inrseivgrplaallandgatvysvdvnniqkftrgeslklnkhhvedlgeysedllkkc
    sldsdvvitgvpsenykfpteyikegavcinfactknfsddvkekaslyvpmtgkvtiam
    llrnmlrlvrnvelske