PDB entry 1ee8

View 1ee8 on RCSB PDB site
Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8
Deposited on 2000-01-31, released 2001-01-31
The last revision prior to the SCOP 1.63 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee8A (A:)
    pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg
    gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr
    lgpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpar
    slteeearrlyralrevlaeavelggstlsdqsyrqpdglpggfqtrhavygreglpcpa
    cgrpverrvvagrgthfcptcqgegp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee8B (B:)
    pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg
    gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr
    lgpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpar
    slteeearrlyralrevlaeavelggstlsdqsyrqpdglpggfqtrhavygreglpcpa
    cgrpverrvvagrgthfcptcqgegp