PDB entry 1ee6

View 1ee6 on RCSB PDB site
Description: crystal structure of pectate lyase from bacillus sp. strain ksm-p15.
Class: lyase
Keywords: Parallel beta-helix, High-alkaline, Low-Molecular-Weight, LYASE
Deposited on 2000-01-31, released 2001-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: Bacillus sp. [TaxId:98226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ee6a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ee6A (A:)
aptvvhetirvpagqtfdgkgqtyvanpntlgdgsqaenqkpifrleagaslknvvigap
aadgvhcygdctitnviwedvgedaltlkssgtvnisggaaykaydkvfqinaagtinir
nfraddigklvrqnggttykvvmnvencnisrvkdailrtdsststgrivntrysnvptl
fkgfksgnttasgntqy