PDB entry 1ee5

View 1ee5 on RCSB PDB site
Description: yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide
Class: transport protein
Keywords: Armadillo repeat, TRANSPORT PROTEIN
Deposited on 2000-01-30, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.241
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: karyopherin alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (Start-423)
      • engineered (310)
    Domains in SCOPe 2.07: d1ee5a_
  • Chain 'B':
    Compound: nucleoplasmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ee5A (A:)
    qelpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpem
    lqleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstd
    yrdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakli
    ysmdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgni
    vtgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlip
    plvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriie
    vtldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiie
    tyfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ee5A (A:)
    pqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlql
    eaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyrd
    yvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliysm
    dtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivtg
    ndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipplv
    kllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievtl
    dalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiietyf
    g
    

  • Chain 'B':
    No sequence available.