PDB entry 1ee4

View 1ee4 on RCSB PDB site
Description: crystal structure of yeast karyopherin (importin) alpha in a complex with a c-myc nls peptide
Class: transport protein
Keywords: ARM repeat, TRANSPORT PROTEIN
Deposited on 2000-01-30, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.246
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: karyopherin alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-422)
      • engineered (310)
    Domains in SCOPe 2.07: d1ee4a_
  • Chain 'B':
    Compound: karyopherin alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-422)
      • engineered (310)
    Domains in SCOPe 2.07: d1ee4b_
  • Chain 'C':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee4A (A:)
    qelpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpem
    lqleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstd
    yrdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakli
    ysmdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgni
    vtgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlip
    plvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriie
    vtldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiie
    tyf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee4B (B:)
    qelpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpem
    lqleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstd
    yrdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakli
    ysmdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgni
    vtgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlip
    plvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriie
    vtldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiie
    tyf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.