PDB entry 1ee2

View 1ee2 on RCSB PDB site
Description: the structure of steroid-active alcohol dehydrogenase at 1.54 a resolution
Class: oxidoreductase
Keywords: dehydrogenase, alcohol, nicotinamide coenzyme, steroid binding, oxidoreductase
Deposited on 2000-01-30, released 2000-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.148
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ee2a1, d1ee2a2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ee2b1, d1ee2b2
  • Heterogens: ZN, NAD, CHD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee2A (A:)
    stagkvikckaavlweqkkpfsieevevappkahevrikmvaagicrsddhvvsgtlvap
    lpviagheaagivesigegvttvrpgdkviplfipqcgkcsvckhpegnlclknlsmprg
    tmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvclvgcgfstgyg
    savkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatecv
    npqdykkpiqevltemsnggvdfsfevigrldtmvaalsccqeaygvsvivgvppdsqnl
    smnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfdl
    lrsgksirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee2B (B:)
    stagkvikckaavlweqkkpfsieevevappkahevrikmvaagicrsddhvvsgtlvap
    lpviagheaagivesigegvttvrpgdkviplfipqcgkcsvckhpegnlclknlsmprg
    tmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvclvgcgfstgyg
    savkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatecv
    npqdykkpiqevltemsnggvdfsfevigrldtmvaalsccqeaygvsvivgvppdsqnl
    smnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfdl
    lrsgksirtiltf