PDB entry 1ee1

View 1ee1 on RCSB PDB site
Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis complexed with one molecule ATP, two molecules deamido-nad+ and one mg2+ ion
Class: ligase
Keywords: lyase, amidotransferase, nh3 dependent, ATP pyrophosphatase, ligase
Deposited on 2000-01-28, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: NADE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ee1a_
  • Chain 'B':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: NADE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ee1b_
  • Heterogens: MG, DND, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee1A (A:)
    smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
    avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
    etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
    ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
    sakvsealekrysmtehkrqvpasmfddwwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ee1B (B:)
    smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
    avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
    etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
    ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
    sakvsealekrysmtehkrqvpasmfddwwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ee1B (B:)
    smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
    avesireeggdaqfiavrlphgeddaqlalkfikpdkswkfdikstvsafsdqyqqetgd
    qltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllpltgl
    tkrqgrtllkelgaperlylisydeiddylegkevsakvsealekrysmtehkrqvpasm
    fddwwk