PDB entry 1ee0

View 1ee0 on RCSB PDB site
Description: 2-pyrone synthase complexed with acetoacetyl-coa
Class: transferase
Keywords: polyketide synthase, thiolase fold, TRANSFERASE
Deposited on 2000-01-28, released 2001-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-pyrone synthase
    Species: Gerbera hybrid cultivar [TaxId:18101]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48391
      • modified residue (168)
      • conflict (258)
    Domains in SCOPe 2.06: d1ee0a1, d1ee0a2
  • Chain 'B':
    Compound: 2-pyrone synthase
    Species: Gerbera hybrid cultivar [TaxId:18101]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48391
      • modified residue (168)
      • conflict (258)
    Domains in SCOPe 2.06: d1ee0b1, d1ee0b2
  • Heterogens: CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ee0A (A:)
    mgsyssddvevireagraqglatilaigtatppncvaqadyadyyfrvtksehmvdlkek
    fkricektaikkrylaltedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaid
    ewglpkskithlifcttagvdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlak
    dlaennkgsrvlivcseitailfhgpnenhldslvaqalfgdgaaalivgsgphlaverp
    ifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalsplgitdw
    nsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevrkrsma
    egksttgegldcgvlfgfgpgmtvetvvlrsvrvtaavangn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ee0A (A:)
    glatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylalte
    dylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifcttag
    vdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlakdlaennkgsrvlivcseit
    ailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtekam
    klhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildqve
    rklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfgfg
    pgmtvetvvlrsvrvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ee0B (B:)
    mgsyssddvevireagraqglatilaigtatppncvaqadyadyyfrvtksehmvdlkek
    fkricektaikkrylaltedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaid
    ewglpkskithlifcttagvdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlak
    dlaennkgsrvlivcseitailfhgpnenhldslvaqalfgdgaaalivgsgphlaverp
    ifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalsplgitdw
    nsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevrkrsma
    egksttgegldcgvlfgfgpgmtvetvvlrsvrvtaavangn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ee0B (B:)
    glatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylalte
    dylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifcttag
    vdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlakdlaennkgsrvlivcseit
    ailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtekam
    klhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildqve
    rklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfgfg
    pgmtvetvvlrsvrv